PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN10859.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 276aa    MW: 31716.6 Da    PI: 5.4326
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN10859.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.61.4e-131461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l + +   G ++W+++++  g+ R++k+c++rw +yl
       KHN10859.1 14 RGPWTIEEDHKLMNFILNNGIHCWRSVPKLAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding52.89.2e-1767110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +T+ E++++++++  lG++ W++Ia++++ gRt++++k++w++
       KHN10859.1  67 RGGFTEMEEDQIIELHSGLGNR-WSKIASHFP-GRTDNEIKNHWNT 110
                      788*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-21564IPR009057Homeodomain-like
PROSITE profilePS5129413.69961IPR017930Myb domain
SuperFamilySSF466894.87E-2811108IPR009057Homeodomain-like
SMARTSM007171.8E-61363IPR001005SANT/Myb domain
PfamPF002495.0E-121461IPR001005SANT/Myb domain
CDDcd001679.95E-51661No hitNo description
PROSITE profilePS5129424.85462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2565116IPR009057Homeodomain-like
SMARTSM007171.0E-1566114IPR001005SANT/Myb domain
PfamPF002498.0E-1567110IPR001005SANT/Myb domain
CDDcd001671.37E-1070110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MGRQPCCDKV GLKRGPWTIE EDHKLMNFIL NNGIHCWRSV PKLAGLLRCG KSCRLRWINY  60
LRPDLKRGGF TEMEEDQIIE LHSGLGNRWS KIASHFPGRT DNEIKNHWNT RIKKRLKLLG  120
LDPVTHKPIE QKENTDENTN KTNPHPSIFG GSEENVEIKS LENGGTKEMA KTEGKREENN  180
KVINWDDTSE LLNNFEMLCS KLDLGSWMMS QETNTSTNSL CSSSVSMDDT SHLSMDESSY  240
LQENSLQQWV DSMDSILSWD GFNPLDQDIL FLENRE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00510DAPTransfer from AT5G14340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150442e-44AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003548543.10.0PREDICTED: myb-related protein 315-like
SwissprotP813942e-80MYB15_ANTMA; Myb-related protein 315
TrEMBLA0A0B2PT780.0A0A0B2PT78_GLYSO; Myb-related protein 315
TrEMBLI1MLP50.0I1MLP5_SOYBN; Uncharacterized protein
STRINGGLYMA16G06900.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66253150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.13e-88myb domain protein 40
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]